- TMEM234 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-90701
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- AASL548, C1orf91, PRO1105, RP4-622L5, dJ622L5.7
- TMEM234
- 0.1 ml (also 25ul)
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: DIGGKRKLDY CECGTQLCGS RHTCVSSFPE PISPEWVRTR PFPILPFPLQ LFCF
- Human
- transmembrane protein 234
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
DIGGKRKLDYCECGTQLCGSRHTCVSSFPEPISPEWVRTRPFPILPFPLQLFCF
Specifications/Features
Available conjugates: Unconjugated